General Information

  • ID:  hor006734
  • Uniprot ID:  P42281
  • Protein name:  Acyl-CoA-binding protein homolog
  • Gene name:  Acbp2
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  Expressed from the larval stage onwards throughout the adult stage. |Expressed in larval and pupal brains. In adults, expressed in cardia, part of the Malpighian tubules, fat body, and gametes of both sexes.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding; GO:0036042 long-chain fatty acyl-CoA binding
  • GO BP:  GO:0006631 fatty acid metabolic process; GO:0042049 intracellular acyl-CoA homeostasis
  • GO CC:  NA

Sequence Information

  • Sequence:  MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA
  • Length:  86
  • Propeptide:  MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters (By similarity). May be involved in energy metabolism in a manner that depends on the substrate used for energy production. Dbi and its metabolites are involved in the regulation of multiple biological processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P42281-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P42281-F1.pdbhor006734_AF2.pdbhor006734_ESM.pdb

Physical Information

Mass: 1107316 Formula: C430H674N112O132S
Absent amino acids: CH Common amino acids: AK
pI: 8.91 Basic residues: 13
Polar residues: 20 Hydrophobic residues: 32
Hydrophobicity: -60.47 Boman Index: -14465
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 71.63
Instability Index: 3952.44 Extinction Coefficient cystines: 15470
Absorbance 280nm: 182

Literature

  • PubMed ID:  7935415
  • Title:  Tissue-specific expression of the diazepam-binding inhibitor in Drosophila melanogaster: cloning, structure, and localization of the gene.
  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  12537569
  • Title:  A Drosophila full-length cDNA resource.